- Recombinant Saccharomyces cerevisiae UPF0041 protein FMP43 (FMP43)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1183680
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,230 Da
- E Coli or Yeast
- 21-146
- MPC3
- UPF0041 protein FMP43 (FMP43)
Sequence
KTVHFWAPTLKWGLVFAGLNDIKRPVEKVSGAQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHLTRIANFRIRNGDSFKQVIHYIIKGETPAAVAAKQTASTSMNKGVIGTNPPITH